KPTN anticorps

N° du produit ABIN631596

Cet anticorps anti-KPTN est un anticorps Lapin Polyclonal détectant KPTN dans WB. Adapté pour Humain, Souris et Rat.

Aperçu rapide pour KPTN anticorps (ABIN631596)

Antigène: KPTN (Kaptin (Actin Binding Protein) (KPTN))

Reactivité: Humain, Souris, Rat

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp KPTN est non-conjugé

Application: Western Blotting (WB)

Détail du produit anti-KPTN anticorps

Purification: Affinity purified

Immunogène: Kaptin antibody was raised using a synthetic peptide corresponding to a region with amino acids MGEAAVAAGPCPLREDSFTRFSSQSNVYGLAGGAGGRGELLAATLKGKVL

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

Kaptin Blocking Peptide, (ABIN5614251), is also available for use as a blocking control in assays to test for specificity of this Kaptin antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of KPTN antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur KPTN

Antigène: KPTN (Kaptin (Actin Binding Protein) (KPTN))

Autre désignation: Kaptin

Sujet: KPTN may be involved in actin dynamics. KPTN may play a role in producing the sensory apparatus in hair cells. KPTN may also play a role in actin rearrangements that accompany platelet activation and stereocilia formation.

Poids moléculaire: 47 kDa (MW of target protein)

Pathways: Sensory Perception of Sound